Rabbit polyclonal antibody for S. cerevisiae |
1704 |
Virostat |
1 ml |
EUR 373.2 |
Description: This is HRP conjugated rabbit polyclonal antibody against S cerevisiae all antigens for WB, ELISA. |
Iga Antibody Laboratories manufactures the iga and igg antibody testing for s. cerevisiae is reagents distributed by Genprice. The Iga And Igg Antibody Testing For S. Cerevisiae Is reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga antibody. Other Iga products are available in stock. Specificity: Iga Category: And Group: Igg Antibody
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
Igg Antibody information
Rabbit Anti Saccharomyces cerevisiae antibody IgA Elisa kit |
E01A27783 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Bovine Anti Saccharomyces cerevisiae antibody IgA Elisa kit |
E01A80079 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Monkey Anti Saccharomyces cerevisiae antibody IgA Elisa kit |
E01A71362 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Canine Anti Saccharomyces cerevisiae antibody IgA Elisa kit |
E01A62649 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Custom Testing of Samples for Antibodies (IgA/IgG/IgM) to S. Pneumococcal vaccines (Penumovax/Prevanr/Synflroix) by ELISA |
560-100-CUX |
Alpha Diagnostics |
Custom |
Ask for price |
Human anti-saccharomyces cerevisiae antibody(IgA) ELISA Kit |
CSB-E15026h-24T |
Cusabio |
1 plate of 24 wells |
EUR 198 |
|
Description: Qualitativeindirect ELISA kit for measuring Human anti-saccharomyces cerevisiae antibody (IgA) in samples from serum, plasma. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human anti-saccharomyces cerevisiae antibody(IgA) ELISA Kit |
1-CSB-E15026h |
Cusabio |
-
EUR 964.80
-
EUR 6118.80
-
EUR 3244.80
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Qualitativeindirect ELISA kit for measuring Human anti-saccharomyces cerevisiae antibody(IgA) in samples from serum, plasma. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human anti-saccharomyces cerevisiae antibody(IgA) Elisa Kit |
EK714180 |
AFG Bioscience LLC |
96 Wells |
EUR 0.43 |
Chicken Anti Saccharomyces cerevisiae antibody IgA Elisa kit |
E01A88805 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Porcine Anti Saccharomyces cerevisiae antibody IgA Elisa kit |
E01A53932 |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
Custom development of ELISAs for other species or antibody isotypes not listed in the catalog. Custom testing of samples for IgG/IgM/IgA or total (IgG+IgM+IgA) |
000-CUS |
Alpha Diagnostics |
Custom |
Ask for price |
Ero1-Like (S. Cerevisiae) Antibody |
20-abx112329 |
Abbexa |
|
|
|
Saccharomyces Cerevisiae Antibody (IgA) (Human) ELISA Kit (OKCA00434) |
OKCA00434 |
Aviva Systems Biology |
96 Wells |
EUR 1030.8 |
Description: Description of target: Saccharomyces cerevisiae Antibody (IgA);Species reactivity: Human;Application: ;Assay info: Assay Methodology: Qualitative Reverse Capture ELISA;Sensitivity: |
Sub1 Homolog (S. Cerevisiae) Antibody |
20-abx115880 |
Abbexa |
|
|
|
Nmd3 Homolog (S. Cerevisiae) Antibody |
20-abx114132 |
Abbexa |
|
|
|
Pwp1 Homolog (S. Cerevisiae) Antibody |
20-abx114928 |
Abbexa |
|
|
|
Rat Anti-ASCA (anti-S. cerevisiae Antibodies or anti-mannan) IgG ELISA Kit, 96 tests, Quantitative |
680-520-ASG |
Alpha Diagnostics |
1 kit |
EUR 854.4 |