Molecules that serve similar functions for different organisms

Iga And Igg Antibody Testing For S. Cerevisiae Is

Rabbit polyclonal antibody for S. cerevisiae

1704 1 ml
EUR 373.2
Description: This is HRP conjugated rabbit polyclonal antibody against S cerevisiae all antigens for WB, ELISA.

Iga Antibody Laboratories manufactures the iga and igg antibody testing for s. cerevisiae is reagents distributed by Genprice. The Iga And Igg Antibody Testing For S. Cerevisiae Is reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga antibody. Other Iga products are available in stock. Specificity: Iga Category: And Group: Igg Antibody

Ero1-Like (S. Cerevisiae) Antibody

  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul

Sub1 Homolog (S. Cerevisiae) Antibody

  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul

Vac14 Homolog (S. Cerevisiae) Antibody

  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul

Ferret Primary Antibody (IgG) Antibody detection and titration and titration ELISA kit, Qualitative (sufficient for 500-1000 tests)

1 kit
EUR 781.2

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Igg Antibody information

Sec11 Homolog A (S. Cerevisiae) Antibody

20-abx115396
  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul

Ero1-Like beta (S. Cerevisiae) Antibody

20-abx112330
  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul

Human anti-saccharomyces cerevisiae antibody(IgA) ELISA Kit

CSB-E15026h-24T 1 plate of 24 wells
EUR 198
Description: Qualitativeindirect ELISA kit for measuring Human anti-saccharomyces cerevisiae antibody (IgA) in samples from serum, plasma. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human anti-saccharomyces cerevisiae antibody(IgA) ELISA Kit

1-CSB-E15026h
  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Qualitativeindirect ELISA kit for measuring Human anti-saccharomyces cerevisiae antibody(IgA) in samples from serum, plasma. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

ERO1-Like (S. Cerevisiae) (ERO1L) Antibody

abx232852-100ug 100 ug
EUR 577.2

ERO1-Like (S. Cerevisiae) (ERO1L) Antibody

abx232853-100ug 100 ug
EUR 610.8

ERO1-Like (S. Cerevisiae) (ERO1L) Antibody

abx036292-100ug 100 ug
EUR 469.2

ERO1-Like (S. Cerevisiae) (ERO1L) Antibody

abx027329-400ul 400 ul
EUR 627.6

ERO1-Like (S. Cerevisiae) (ERO1L) Antibody

abx027329-80l 80 µl
EUR 343.2

Saccharomyces Cerevisiae Antibody (IgA) (Human) ELISA Kit (OKCA00434)

OKCA00434 96 Wells
EUR 1030.8
Description: Description of target: Saccharomyces cerevisiae Antibody (IgA);Species reactivity: Human;Application: ;Assay info: Assay Methodology: Qualitative Reverse Capture ELISA;Sensitivity:

Rat Anti-ASCA (anti-S. cerevisiae Antibodies or anti-mannan) IgG ELISA Kit, 96 tests, Quantitative

680-520-ASG 1 kit
EUR 854.4

Mouse Anti-ASCA (anti-S. cerevisiae Antibodies or anti-mannan) IgG ELISA Kit, 96 tests, Quantitative

680-500-ASG 1 Kit
EUR 854.4

Sar1 Homolog B (S. Cerevisiae) (SAR1B) Antibody

20-abx115379
  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul

Sec61 alpha 1 Subunit (S. Cerevisiae) Antibody

20-abx115403
  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul

ERO1-Like Beta (S. Cerevisiae) (ERO1LB) Antibody

abx232854-100ug 100 ug
EUR 577.2

ERO1-Like Beta (S. Cerevisiae) (ERO1LB) Antibody

abx232855-100ug 100 ug
EUR 610.8

Partner Of Nob1 Homolog (S. Cerevisiae) Antibody

20-abx114339
  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul