Molecules that serve similar functions for different organisms

Iga And Igg Antibody Testing For S. Cerevisiae Is

Rabbit polyclonal antibody for S. cerevisiae

1704 1 ml
EUR 373.2
Description: This is HRP conjugated rabbit polyclonal antibody against S cerevisiae all antigens for WB, ELISA.

Iga Antibody Laboratories manufactures the iga and igg antibody testing for s. cerevisiae is reagents distributed by Genprice. The Iga And Igg Antibody Testing For S. Cerevisiae Is reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga antibody. Other Iga products are available in stock. Specificity: Iga Category: And Group: Igg Antibody

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Igg Antibody information

Rabbit Anti Saccharomyces cerevisiae antibody IgA Elisa kit

E01A27783 96T
EUR 700
Description: ELISA

Bovine Anti Saccharomyces cerevisiae antibody IgA Elisa kit

E01A80079 96T
EUR 700
Description: ELISA

Monkey Anti Saccharomyces cerevisiae antibody IgA Elisa kit

E01A71362 96T
EUR 700
Description: ELISA

Canine Anti Saccharomyces cerevisiae antibody IgA Elisa kit

E01A62649 96T
EUR 700
Description: ELISA

Custom Testing of Samples for Antibodies (IgA/IgG/IgM) to S. Pneumococcal vaccines (Penumovax/Prevanr/Synflroix) by ELISA

560-100-CUX Custom Ask for price

Human anti-saccharomyces cerevisiae antibody(IgA) ELISA Kit

CSB-E15026h-24T 1 plate of 24 wells
EUR 198
Description: Qualitativeindirect ELISA kit for measuring Human anti-saccharomyces cerevisiae antibody (IgA) in samples from serum, plasma. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human anti-saccharomyces cerevisiae antibody(IgA) ELISA Kit

1-CSB-E15026h
  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Qualitativeindirect ELISA kit for measuring Human anti-saccharomyces cerevisiae antibody(IgA) in samples from serum, plasma. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human anti-saccharomyces cerevisiae antibody(IgA) Elisa Kit

EK714180 96 Wells
EUR 0.43

Chicken Anti Saccharomyces cerevisiae antibody IgA Elisa kit

E01A88805 96T
EUR 700
Description: ELISA

Porcine Anti Saccharomyces cerevisiae antibody IgA Elisa kit

E01A53932 96T
EUR 700
Description: ELISA

Custom development of ELISAs for other species or antibody isotypes not listed in the catalog. Custom testing of samples for IgG/IgM/IgA or total (IgG+IgM+IgA)

000-CUS Custom Ask for price

Ero1-Like (S. Cerevisiae) Antibody

20-abx112329
  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul

Saccharomyces Cerevisiae Antibody (IgA) (Human) ELISA Kit (OKCA00434)

OKCA00434 96 Wells
EUR 1030.8
Description: Description of target: Saccharomyces cerevisiae Antibody (IgA);Species reactivity: Human;Application: ;Assay info: Assay Methodology: Qualitative Reverse Capture ELISA;Sensitivity:

Sub1 Homolog (S. Cerevisiae) Antibody

20-abx115880
  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul

Nmd3 Homolog (S. Cerevisiae) Antibody

20-abx114132
  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul

Pwp1 Homolog (S. Cerevisiae) Antibody

20-abx114928
  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul

Rat Anti-ASCA (anti-S. cerevisiae Antibodies or anti-mannan) IgG ELISA Kit, 96 tests, Quantitative

680-520-ASG 1 kit
EUR 854.4